# |
Title Sites are ordered by votes (all time). |
Votes (90 Days) |
Votes (All Time) |
Hits | ||
---|---|---|---|---|---|---|
50 | indiaemporiumOnline shopping portal! | 0 | 0 | 19 | Vote Comments | |
50 | website designer,website design pricing,free website design,Your Code- IB-2402 Create Your Own Custom Website Our 5-Page Site has All You Need Brochure Sites rs. 3500/- Reply us For a Free Quote Get a Basic Website Designed from 3500Rs. which includes one Flash Home Page + 5 Additional pages +1 Mini Flash + | 0 | 0 | 23 | Vote Comments | |
50 | E MediaElectronic Media(FOLJID211188) We are the digital arm of the New Straits Times Press. We are IT savvy, gadget-loving and hip, and we strategies and execute the company’s positioning and direction for new media. We are passionate about the digital space. | 0 | 0 | 13 | Vote Comments | |
50 | allsat satellite | 0 | 0 | 33 | Vote Comments | |
50 | Da-OriginalCome to my forum da-original if you wanna just kick back on your chair and chit chat chit chat so if you bored and wanna talk about anything you want sign up http://da-original.gooforum.com | 0 | 0 | 16 | Vote Comments | |
50 | Work at Home with Profit ArticleComplete training, software and resources to create income from submitting articles to the Web for pay. You can make solid, easy money from the comfort of your home by typing simple content and articles for Web sites on the Internet. You can be making $10 | 0 | 0 | 14 | Vote Comments | |
50 | usmanwereyhtrvadscsdgergsdcsdfvdfwe | 0 | 0 | 63 | Vote Comments | |
50 | Ijinni Tech SupportIJinni is the world’s-fastest growing award winning provider of remote tech support across US and Europe providing PRO-ACTIVE and UNLIMITED maintenance for all kinds of devices like your PCs, laptops, printers, iPads, iPods, iPhones, blackberry and Androi | 0 | 0 | 12 | Vote Comments | |
50 | ![]() | Adventure EquipmentsAdventure Equipments is Outdoor Products, Adventure and Aqua Equipments Manufacturer and Supplier Company located in Delhi, India | 0 | 0 | 27 | Vote Comments |
50 | ![]() | Rugsandblinds.comRugsandBlinds.com discounts hands crafted rugs in various styles, dimensions and supplies including hands tufted rugs as well as fleece rugs. | 0 | 0 | 18 | Vote Comments |
50 | ![]() | Anything UpholsteryAnything Upholstery, the best place to bring you the finest selection of commercial, auto, marine and residential grade fabrics, all at wholesale prices Contact: Anything Upholstery Phone: 1-888-317-8720 Website: http://www.anythingupholstery.com | 0 | 0 | 22 | Vote Comments |
50 | ![]() | www.connectindia.comUnlimited Web Hosting & Bandwidth with free domains. Get Unlimited Web space, Unlimited Bandwidth & FREE Domain Start your own website with No:1 Hosting company * Unlimited Storage * Unlimited Bandwidth * 24/7 support * Easy control panel. | 0 | 0 | 14 | Vote Comments |
50 | ![]() | Personalized PencilsPromotional gifts do not need to be expensive to achieve excellent results. It is the good quality, useful gifts that are used the most and promote the best. Personalized Pencils are used everyday around the office. They offer a low cost way to promote yo | 0 | 0 | 21 | Vote Comments |
50 | Rent to Own in NottinghamRenting to own is the new solution to most of our real estate problems now. | 0 | 0 | 18 | Vote Comments | |
50 | Digital/Internet Marketing Company in IndiaIndian Online Marketing is a Digital/Internet marketing services company that specializes in Search Engine Optimization, Search Engine Marketing, PPC Management Campaign, Online Advertising, Social Media Marketing, E-mail Marketing, Mobile Marketing, Onli | 0 | 0 | 18 | Vote Comments |